CRYM anticorps (Middle Region)

N° du produit ABIN630565

Cet anticorps Lapin Polyclonal détecte spécifiquement CRYM dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour CRYM anticorps (Middle Region) (ABIN630565)

Antigène: CRYM (Crystallin, mu (CRYM))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CRYM est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CRYM anticorps

Épitope: Middle Region

Specificité: Crystallin Mu antibody was raised against the middle region of CRYM

Purification: Affinity purified

Immunogène: Crystallin Mu antibody was raised using the middle region of CRYM corresponding to a region with amino acids AHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Crystallin Mu Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Crystallin Mu antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRYM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CRYM

Antigène: CRYM (Crystallin, mu (CRYM))

Autre désignation: Crystallin mu

Sujet: Crystallins are separated into two classes: taxon-specific and ubiquitous. The former class is also called phylogenetically-restricted crystallins. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. This gene encodes a taxon-specific crystallin protein that binds NADPH and has sequence similarity to bacterial ornithine cyclodeaminases.

Poids moléculaire: 30 kDa (MW of target protein)

Pathways: Hormone Transport, Sensory Perception of Sound